PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_12940A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 274aa    MW: 29880.1 Da    PI: 9.2529
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_12940AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-171461148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+WT+eEd++l+ ++k +G g+W++ ++  g+ R++k+c++rw +yl
  Oropetium_20150105_12940A 14 KGAWTKEEDQRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWMNYL 61
                               79******************************99************97 PP

2Myb_DNA-binding54.33.1e-1767111147
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                rg++T ++del+++++++lG++ W++Ia  ++ gRt++++k++w+++
  Oropetium_20150105_12940A  67 RGNFTDDDDELIIKLHALLGNK-WSLIAGQLP-GRTDNEIKNYWNTH 111
                                89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.7E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.243961IPR017930Myb domain
SMARTSM007174.1E-141363IPR001005SANT/Myb domain
SuperFamilySSF466896.13E-2913108IPR009057Homeodomain-like
PfamPF002491.1E-151461IPR001005SANT/Myb domain
CDDcd001674.89E-121661No hitNo description
PROSITE profilePS5129427.64762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.7E-2765116IPR009057Homeodomain-like
SMARTSM007174.0E-1666114IPR001005SANT/Myb domain
PfamPF002493.3E-1567111IPR001005SANT/Myb domain
CDDcd001672.15E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLIAYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWMNY  60
LRPDLKRGNF TDDDDELIIK LHALLGNKWS LIAGQLPGRT DNEIKNYWNT HIKRKLLSRG  120
IDPQTHRPLS AGSSGLTTSS TTAGCFPSTA APASRLARPV ITVPPPANVM FAAARSAPSE  180
SSSGGSGTTD APRCPDLNLD LDLDLSVGPP SCSPRXXXXX XXXXXXXQQQ QQRTPICLCY  240
HLGVRGREAC SCKAGSPSPA FRFLRPLEEG QYI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-29141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519111e-173JF951911.1 Triticum aestivum clone TaMYB28 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456719.11e-146hypothetical protein SORBIDRAFT_03g041360
SwissprotP813932e-93MYB08_ANTMA; Myb-related protein 308
TrEMBLC5XRB41e-146C5XRB4_SORBI; Putative uncharacterized protein Sb03g041360
STRINGSb03g041360.11e-146(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.11e-86myb domain protein 6